SCOPe 2.08: Domain d4lnjb_: 4lnj B:

Lineage for d4lnjb_ (4lnj B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Escherichia coli [TaxId:945433] [267966] (3 PDB entries)

8. Domain d4lnjb_: 4lnj B: [266680]
   automated match to d3wgba_
   complexed with epe, mg, plr

Details for d4lnjb_

PDB Entry: 4lnj, 2.1 Å

PDB Description: Structure of Escherichia coli Threonine Aldolase in Unliganded Form

PDB Compounds: (B:) Low-specificity L-threonine aldolase

SCOPe Domain Sequences for d4lnjb_:

Sequence; same for both SEQRES and ATOM records:

>d4lnjb_ c.67.1.0 (B:) automated matches {Escherichia coli [TaxId: 945433]}
midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
inaspivrlvthldvsraqlaevaahwrafla

Timeline for d4lnjb_:

• d4lnjb_ first appeared in SCOPe 2.05
  
• d4lnjb_ appears in SCOPe 2.07