PDB entry 4lnj

View 4lnj on RCSB PDB site
Description: Structure of Escherichia coli Threonine Aldolase in Unliganded Form
Class: lyase
Keywords: Threonine aldolase, vitamin B6, PLP, aldimine, Fold Type 1, amino acid synthesis, LYASE
Deposited on 2013-07-11, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low-specificity L-threonine aldolase
    Species: Escherichia coli [TaxId:945433]
    Gene: EcoM_01176, ltaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7U392 (0-End)
      • conflict (255-256)
    Domains in SCOPe 2.07: d4lnja_
  • Chain 'B':
    Compound: Low-specificity L-threonine aldolase
    Species: Escherichia coli [TaxId:945433]
    Gene: EcoM_01176, ltaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot E7U392 (0-End)
      • conflict (255-256)
    Domains in SCOPe 2.07: d4lnjb_
  • Heterogens: MG, PLR, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lnjA (A:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwraflar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnjA (A:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwrafla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lnjB (B:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwraflar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnjB (B:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrkrnlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagmy
    alknnvarlqedhdntawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsraqlaevaahwrafla