Lineage for d4l95g_ (4l95 G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467511Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2467512Protein automated matches [190197] (24 species)
    not a true protein
  7. 2467777Species Zebrafish (Danio rerio) [TaxId:7955] [256984] (5 PDB entries)
  8. 2467801Domain d4l95g_: 4l95 G: [266644]
    automated match to d4l8wb_
    complexed with gol

Details for d4l95g_

PDB Entry: 4l95 (more details), 2.34 Å

PDB Description: Crystal structure of gamma glutamyl hydrolase (H218N) from zebrafish
PDB Compounds: (G:) gamma-glutamyl hydrolase

SCOPe Domain Sequences for d4l95g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l95g_ c.23.16.0 (G:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
kkfyrvlstntdgynkfvstmeaydfpiyatqwnpeknafewtrpyiphtpsaikttfym
anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn

SCOPe Domain Coordinates for d4l95g_:

Click to download the PDB-style file with coordinates for d4l95g_.
(The format of our PDB-style files is described here.)

Timeline for d4l95g_: