| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
| Protein automated matches [190197] (20 species) not a true protein |
| Species Zebrafish (Danio rerio) [TaxId:7955] [256984] (5 PDB entries) |
| Domain d4l95f_: 4l95 F: [266643] automated match to d4l8wb_ complexed with gol |
PDB Entry: 4l95 (more details), 2.34 Å
SCOPe Domain Sequences for d4l95f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l95f_ c.23.16.0 (F:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
kkfyrvlstntdgynkfvstmeaydfpiyatqwnpeknafewtrpyiphtpsaikttfym
anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn
Timeline for d4l95f_: