Lineage for d4k4im3 (4k4i M:386-575)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2612791Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2612969Protein DNA polymerase lambda [102943] (1 species)
  7. 2612970Species Human (Homo sapiens) [TaxId:9606] [102944] (27 PDB entries)
  8. 2613005Domain d4k4im3: 4k4i M:386-575 [266531]
    Other proteins in same PDB: d4k4ia1, d4k4ia2, d4k4ia4, d4k4ie1, d4k4ie2, d4k4ie4, d4k4ii1, d4k4ii2, d4k4ii4, d4k4im1, d4k4im2, d4k4im4
    automated match to d2bcqa3
    protein/DNA complex; complexed with 1ry, act, ca, cac

Details for d4k4im3

PDB Entry: 4k4i (more details), 2.25 Å

PDB Description: ternary crystal structures of a human dna polymerase lambda in complex with dna and (-)ftc-tp.
PDB Compounds: (M:) DNA polymerase lambda

SCOPe Domain Sequences for d4k4im3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4im3 d.218.1.2 (M:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldiivvpysefacally
ftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllgl
pyrepaerdw

SCOPe Domain Coordinates for d4k4im3:

Click to download the PDB-style file with coordinates for d4k4im3.
(The format of our PDB-style files is described here.)

Timeline for d4k4im3: