SCOPe 2.06: Domain d4imlh2: 4iml H:131-234

Lineage for d4imlh2 (4iml H:131-234)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4imlh2: 4iml H:131-234 [266457]
   automated match to d1igtb4
   complexed with gol

Details for d4imlh2

PDB Entry: 4iml, 2.93 Å

PDB Description: CrossFab binding to human Angiopoietin 2

PDB Compounds: (H:) Crossed heavy chain (VH-Ckappa)

SCOPe Domain Sequences for d4imlh2:

Sequence; same for both SEQRES and ATOM records:

>d4imlh2 b.1.1.0 (H:131-234) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4imlh2:

• d4imlh2 first appeared in SCOPe 2.05
  
• d4imlh2 appears in SCOPe 2.07
  
• d4imlh2 appears in the current release, SCOPe 2.08