SCOPe 2.08: Domain d4hx1a2: 4hx1 A:182-274

Lineage for d4hx1a2 (4hx1 A:182-274)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d4hx1a2: 4hx1 A:182-274 [266370]
   Other proteins in same PDB: d4hx1a1
   automated match to d3gsua2
   complexed with gol

Details for d4hx1a2

PDB Entry: 4hx1, 1.8 Å

PDB Description: Structure of HLA-A68 complexed with a tumor antigen derived peptide

PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d4hx1a2:

Sequence; same for both SEQRES and ATOM records:

>d4hx1a2 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlkw

Timeline for d4hx1a2:

• d4hx1a2 first appeared in SCOPe 2.05
  
• d4hx1a2 appears in SCOPe 2.07