SCOPe 2.08: Domain d4hx1a1: 4hx1 A:1-181

Lineage for d4hx1a1 (4hx1 A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [54472] (4 PDB entries)

8. Domain d4hx1a1: 4hx1 A:1-181 [266369]
   Other proteins in same PDB: d4hx1a2
   automated match to d1hsba2
   complexed with gol

Details for d4hx1a1

PDB Entry: 4hx1, 1.8 Å

PDB Description: Structure of HLA-A68 complexed with a tumor antigen derived peptide

PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d4hx1a1:

Sequence; same for both SEQRES and ATOM records:

>d4hx1a1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-AW68 [TaxId: 9606]}
gshsmryfytsmsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
drntrnvkaqsqtdrvdlgtlrgyynqseagshtiqrmygcdvgpdgrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqwraylegtcvewlrrylengketlq
r

Timeline for d4hx1a1:

• d4hx1a1 first appeared in SCOPe 2.05
  
• d4hx1a1 appears in SCOPe 2.07