SCOPe 2.07: Domain d4ffka1: 4ffk A:14-105

Lineage for d4ffka1 (4ffk A:14-105)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (38 species)
   not a true protein

7. Species Acidilobus saccharovorans [TaxId:666510] [267931] (1 PDB entry)

8. Domain d4ffka1: 4ffk A:14-105 [266247]
   Other proteins in same PDB: d4ffka2, d4ffka3
   automated match to d1p7ga1
   complexed with fe

Details for d4ffka1

PDB Entry: 4ffk, 1.76 Å

PDB Description: x-ray structure of iron superoxide dismutase from acidilobus saccharovorans

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4ffka1:

Sequence; same for both SEQRES and ATOM records:

>d4ffka1 a.2.11.0 (A:14-105) automated matches {Acidilobus saccharovorans [TaxId: 666510]}
vslkryelpplpynydalepiisaetlryhhdkhhlgyvnganaaldklekylngqltdi
dvravsrdfefnygghilhtlywlnmapkgkg

Timeline for d4ffka1:

• d4ffka1 first appeared in SCOPe 2.05
  
• d4ffka1 appears in SCOPe 2.06
  
• d4ffka1 appears in the current release, SCOPe 2.08