Lineage for d4d1md_ (4d1m D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328122Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2328123Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2328184Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 2328185Protein automated matches [259190] (2 species)
    not a true protein
  7. 2328230Species Zebrafish (Danio rerio) [TaxId:7955] [259192] (5 PDB entries)
  8. 2328254Domain d4d1md_: 4d1m D: [266145]
    automated match to d4d1lb_
    complexed with zn

Details for d4d1md_

PDB Entry: 4d1m (more details), 2.2 Å

PDB Description: tetramerization domain of zebrafish p53 (crystal form ii)
PDB Compounds: (D:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4d1md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d1md_ a.53.1.0 (D:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
eiftlqvrgreryeilkklndslelsdvvpasdaekyrq

SCOPe Domain Coordinates for d4d1md_:

Click to download the PDB-style file with coordinates for d4d1md_.
(The format of our PDB-style files is described here.)

Timeline for d4d1md_: