| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (49 species) not a true protein |
| Species Caulobacter vibrioides [TaxId:155892] [256751] (9 PDB entries) |
| Domain d4czjb2: 4czj B:150-334 [266129] automated match to d4czla2 complexed with anp, mg |
PDB Entry: 4czj (more details), 2 Å
SCOPe Domain Sequences for d4czjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4czjb2 c.55.1.0 (B:150-334) automated matches {Caulobacter vibrioides [TaxId: 155892]}
lpiheptgsmvvdigggttevavlslsgivysrsvrvggdkmdeaiisymrrhhnllige
ttaerikkeigtarapadgeglsidvkgrdlmqgvprevrisekqaadalaepvgqivea
vkvaleatppelasdiadkgimltgggallrgldaeirdhtglpvtvaddplscvalgcg
kvleh
Timeline for d4czjb2: