Lineage for d4czla2 (4czl A:150-347)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858550Species Caulobacter vibrioides [TaxId:155892] [256751] (9 PDB entries)
  8. 1858556Domain d4czla2: 4czl A:150-347 [256757]
    automated match to d1jcfa2
    complexed with adp, mg

Details for d4czla2

PDB Entry: 4czl (more details), 1.6 Å

PDB Description: C. crescentus MreB, monomeric, ADP
PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d4czla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4czla2 c.55.1.0 (A:150-347) automated matches {Caulobacter vibrioides [TaxId: 155892]}
lpiheptgsmvvdigggttevavlslsgivysrsvrvggdkmdeaiisymrrhhnllige
ttaerikkeigtarapadgeglsidvkgrdlmqgvprevrisekqaadalaepvgqivea
vkvaleatppeladdiadkgimltgggallrgldaeirdhtglpvtvaddplscvalgcg
kvlehpkwmkgvlestla

SCOPe Domain Coordinates for d4czla2:

Click to download the PDB-style file with coordinates for d4czla2.
(The format of our PDB-style files is described here.)

Timeline for d4czla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4czla1