Lineage for d4czga1 (4czg A:9-149)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138470Species Caulobacter vibrioides [TaxId:155892] [256751] (9 PDB entries)
  8. 2138471Domain d4czga1: 4czg A:9-149 [266120]
    automated match to d4czfa1
    complexed with adp, mg, qh3

Details for d4czga1

PDB Entry: 4czg (more details), 1.5 Å

PDB Description: C. crescentus MreB, single filament, ADP, A22 inhibitor
PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d4czga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4czga1 c.55.1.0 (A:9-149) automated matches {Caulobacter vibrioides [TaxId: 155892]}
isndiaidlgtantliyqkgkgivlnepsvvalrnvggrkvvhavgieakqmlgrtpghm
eairpmrdgviadfevaeemikyfirkvhnrkgsgnpkvivcvpsgataverraindscl
nagarrvglidepmaaaigag

SCOPe Domain Coordinates for d4czga1:

Click to download the PDB-style file with coordinates for d4czga1.
(The format of our PDB-style files is described here.)

Timeline for d4czga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4czga2