Lineage for d4cxta_ (4cxt A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903467Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1903468Protein automated matches [190710] (3 species)
    not a true protein
  7. 1903469Species Human (Homo sapiens) [TaxId:9606] [187857] (25 PDB entries)
  8. 1903529Domain d4cxta_: 4cxt A: [266109]
    automated match to d4cxja_
    complexed with sxj

Details for d4cxta_

PDB Entry: 4cxt (more details), 2.66 Å

PDB Description: BTB domain of KEAP1 in complex with CDDO
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4cxta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cxta_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfk
amftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvv
racadflvqqld

SCOPe Domain Coordinates for d4cxta_:

Click to download the PDB-style file with coordinates for d4cxta_.
(The format of our PDB-style files is described here.)

Timeline for d4cxta_: