Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein Eukaryotic, cytoplasmic (60S subunit) [267687] (1 species) |
Species Tetrahymena thermophila [TaxId:5911] [268006] (2 PDB entries) |
Domain d4a19g_: 4a19 G: [265884] protein/RNA complex; complexed with zn |
PDB Entry: 4a19 (more details), 3.52 Å
SCOPe Domain Sequences for d4a19g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a19g_ i.1.1.2 (G:) Eukaryotic, cytoplasmic (60S subunit) {Tetrahymena thermophila [TaxId: 5911]} dniqsklalvmrsgkatlgykstikairngtaklvfisnncptvrkseieyyaslaqisi hhfvgsnvelgtacgkyhrcstmaildagdsdilkt
Timeline for d4a19g_: