Lineage for d4a17o_ (4a17 O:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043574Protein Eukaryotic, cytoplasmic (60S subunit) [267687] (1 species)
  7. 3043575Species Tetrahymena thermophila [TaxId:5911] [268006] (2 PDB entries)
  8. 3043590Domain d4a17o_: 4a17 O: [265868]
    protein/RNA complex; complexed with mg, zn

Details for d4a17o_

PDB Entry: 4a17 (more details), 3.52 Å

PDB Description: T.thermophila 60S ribosomal subunit in complex with initiation factor 6. This file contains 5S rRNA, 5.8S rRNA and proteins of molecule 2.
PDB Compounds: (O:) rpl19

SCOPe Domain Sequences for d4a17o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a17o_ i.1.1.2 (O:) Eukaryotic, cytoplasmic (60S subunit) {Tetrahymena thermophila [TaxId: 5911]}
vslrlqkrlaasvlkcgqkrlwldpnesseismansrasirklikdglvmkrstvihsrs
rarafleakrkgrhtgsgkrkgtrnarmptkvlwmrrqrvlrrllrkyraakkidkhqyh
efylgskgnlyknktvlieaihvskaxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SCOPe Domain Coordinates for d4a17o_:

Click to download the PDB-style file with coordinates for d4a17o_.
(The format of our PDB-style files is described here.)

Timeline for d4a17o_: