![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.2: Large subunit [58124] (3 proteins) |
![]() | Protein Eukaryotic, cytoplasmic (60S subunit) [267687] (1 species) |
![]() | Species Tetrahymena thermophila [TaxId:5911] [268006] (2 PDB entries) |
![]() | Domain d4a17t_: 4a17 T: [265873] protein/RNA complex; complexed with mg, zn |
PDB Entry: 4a17 (more details), 3.52 Å
SCOPe Domain Sequences for d4a17t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a17t_ i.1.1.2 (T:) Eukaryotic, cytoplasmic (60S subunit) {Tetrahymena thermophila [TaxId: 5911]} vvrtgtcsfceyriypgrgqrfiakdgrgfffltkkakclslrkvkaqkitwtiarrrlw k
Timeline for d4a17t_: