SCOPe 2.07: Domain d3zn0a3: 3zn0 A:655-763

Lineage for d3zn0a3 (3zn0 A:655-763)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159954] (27 PDB entries)
   Uniprot O60341 655-763

8. Domain d3zn0a3: 3zn0 A:655-763 [265846]
   Other proteins in same PDB: d3zn0a1, d3zn0a2, d3zn0b1, d3zn0b2
   complexed with fad

Details for d3zn0a3

PDB Entry: 3zn0, 2.8 Å

PDB Description: LSD1-CoREST in complex with PRSFAA peptide

PDB Compounds: (A:) Lysine-specific histone demethylase 1A

SCOPe Domain Sequences for d3zn0a3:

Sequence; same for both SEQRES and ATOM records:

>d3zn0a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

Timeline for d3zn0a3:

• d3zn0a3 first appeared in SCOPe 2.05
  
• d3zn0a3 appears in SCOPe 2.06
  
• d3zn0a3 appears in the current release, SCOPe 2.08