Class b: All beta proteins [48724] (177 folds) |
Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily) barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices |
Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) automatically mapped to Pfam PF02312 |
Family b.54.1.1: Core binding factor beta, CBF [50724] (2 proteins) |
Protein automated matches [259048] (1 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [259049] (7 PDB entries) |
Domain d3wttg_: 3wtt G: [265774] Other proteins in same PDB: d3wtta_, d3wttc_, d3wttf_ automated match to d2jhba_ protein/DNA complex |
PDB Entry: 3wtt (more details), 2.35 Å
SCOPe Domain Sequences for d3wttg_:
Sequence, based on SEQRES records: (download)
>d3wttg_ b.54.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrldg mgclefdeeraqqedalaq
>d3wttg_ b.54.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg tnlslqffpapsreyvdlereagkvylkapmilngvcviwkgwidlhrldgmgclefdee raqqedalaq
Timeline for d3wttg_:
View in 3D Domains from other chains: (mouse over for more information) d3wtta_, d3wttb_, d3wttc_, d3wttf_ |