![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
![]() | Protein automated matches [190245] (12 species) not a true protein |
![]() | Species Camellia sinensis [TaxId:4442] [256516] (3 PDB entries) |
![]() | Domain d3wq5b_: 3wq5 B: [265719] automated match to d1cbga_ complexed with nag, vpa |
PDB Entry: 3wq5 (more details), 1.8 Å
SCOPe Domain Sequences for d3wq5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wq5b_ c.1.8.4 (B:) automated matches {Camellia sinensis [TaxId: 4442]} fnrtsfpdgfvfgaassayqfegaakeggkgpniwdtfthefpgkisngstgdvaddfyh rykedvkvlkfigldgfrmsiswarvlprgklsggvnkegiafynnvindllskgiqpfi tifhwdlpqaledeyggflsphivndfrdfaelcfkefgdrvkhwitmnepwsysyggyd agllapgrcsafmafcpkgnsgtepyivthnlllshaaavklykekyqayqkgqigitlv tywmipysnskadkdaaqraldfmygwfieplsfgeypksmrrlvgkrlprftkeqamlv kgsfdflglnyyianyvlnvptsnsvnlsyttdslsnqtafrngvaigrptgvpaffmyp kglkdllvytkekyndpviyitengmgdnnnvtteegikdpqrvyfynqhllslknaiaa gvkvkgyftwafldnfewlsgytqrfgivyvdfkdglkrypkhsalwfkkfllk
Timeline for d3wq5b_: