SCOPe 2.08: Domain d3wlxa_: 3wlx A:

Lineage for d3wlxa_ (3wlx A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [257757] (5 PDB entries)

8. Domain d3wlxa_: 3wlx A: [265688]
   automated match to d3wgba_
   complexed with plg

Details for d3wlxa_

PDB Entry: 3wlx, 2.51 Å

PDB Description: Crystal structure of low-specificity L-threonine aldolase from Escherichia coli

PDB Compounds: (A:) Low specificity L-threonine aldolase

SCOPe Domain Sequences for d3wlxa_:

Sequence; same for both SEQRES and ATOM records:

>d3wlxa_ c.67.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
kpddihfartkllslenthngkvlpreylkeaweftrernlalhvdgarifnavvaygce
lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagiy
alknnvarlqedhdnaawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
inaspivrlvthldvsreqlaevaahwrafl

Timeline for d3wlxa_:

• d3wlxa_ first appeared in SCOPe 2.05
  
• d3wlxa_ appears in SCOPe 2.07