PDB entry 3wlx

View 3wlx on RCSB PDB site
Description: Crystal structure of low-specificity L-threonine aldolase from Escherichia coli
Class: lyase
Keywords: Threonine aldolase, Low specificity, Pyridoxal-5'-phosphate, stereoselectivity, LYASE
Deposited on 2013-11-15, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.185
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low specificity L-threonine aldolase
    Species: Escherichia coli [TaxId:83333]
    Gene: b0870, JW0854, ltaE, ybjU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wlxa_
  • Chain 'B':
    Compound: Low specificity L-threonine aldolase
    Species: Escherichia coli [TaxId:83333]
    Gene: b0870, JW0854, ltaE, ybjU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3wlxb_
  • Heterogens: PLG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wlxA (A:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrernlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagiy
    alknnvarlqedhdnaawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsreqlaevaahwraflar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wlxA (A:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrernlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagiy
    alknnvarlqedhdnaawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsreqlaevaahwrafl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3wlxB (B:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrernlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagiy
    alknnvarlqedhdnaawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsreqlaevaahwraflar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wlxB (B:)
    midlrsdtvtrpsramleammaapvgddvygddptvnalqdyaaelsgkeaaiflptgtq
    anlvallshcergeeyivgqaahnylfeaggaavlgsiqpqpidaaadgtlpldkvamki
    kpddihfartkllslenthngkvlpreylkeaweftrernlalhvdgarifnavvaygce
    lkeitqycdsfticlskglgtpvgsllvgnrdyikrairwrkmtgggmrqsgilaaagiy
    alknnvarlqedhdnaawmaeqlreagadvmrqdtnmlfvrvgeenaaalgeymkarnvl
    inaspivrlvthldvsreqlaevaahwrafla