Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267998] (4 PDB entries) Because SCOP is not case sensitive, we included upper case chains from 3u5c and 3u5e and lower case chains from 3u5g and 3u5i |
Domain d3u5cw_: 3u5c W: [265453] protein/RNA complex; complexed with zn |
PDB Entry: 3u5c (more details), 3 Å
SCOPe Domain Sequences for d3u5cw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u5cw_ i.1.1.1 (W:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} trssvladalnainnaektgkrqvlirpsskviikflqvmqkhgyigefeyiddhrsgki vvqlngrlnkcgvisprfnvkigdiekwtanllparqfgyvilttsagimdheearrkhv sgkilgfvy
Timeline for d3u5cw_: