Lineage for d3pzoa_ (3pzo A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833252Species Thermotoga petrophila [TaxId:390874] [267872] (6 PDB entries)
  8. 2833257Domain d3pzoa_: 3pzo A: [265239]
    automated match to d3ziza_
    complexed with gol

Details for d3pzoa_

PDB Entry: 3pzo (more details), 1.55 Å

PDB Description: structure of the hyperthermostable endo-1,4-beta-d-mannanase from thermotoga petrophila rku-1 in complex with three maltose molecules
PDB Compounds: (A:) Mannan endo-1,4-beta-mannosidase. Glycosyl Hydrolase family 5

SCOPe Domain Sequences for d3pzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pzoa_ c.1.8.0 (A:) automated matches {Thermotoga petrophila [TaxId: 390874]}
frfigsnnyymhyksnrmidsvlesardmgikvlriwgfldgesycrdkntymhpepgvf
gvpegisnaqngferldytiakakelgikliivlvnnwddfggmnqyvrwfggthhddfy
rderikeeykkyvsflinhvnvytgvpyreeptimawelanelrcetdksgntlvewvke
mssyiksldpnhlvavgdegffsnyegfkpyggeaewayngwsgvdwkkllsietvdfgt
fhlypshwgvspenyaqwgakwiedhikiakeigkpvvleeygipksapvnrtaiyrlwn
dlvydlggdgamfwmlagigegsdrdergyypdydgfrivnddspeaelireyaklf

SCOPe Domain Coordinates for d3pzoa_:

Click to download the PDB-style file with coordinates for d3pzoa_.
(The format of our PDB-style files is described here.)

Timeline for d3pzoa_: