Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) |
Family b.42.5.0: automated matches [267627] (1 protein) not a true family |
Protein automated matches [267678] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [267866] (2 PDB entries) |
Domain d3p53a2: 3p53 A:141-259 [265138] automated match to d3llpa2 complexed with 12p, 1pe, gol, pg0 |
PDB Entry: 3p53 (more details), 2 Å
SCOPe Domain Sequences for d3p53a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p53a2 b.42.5.0 (A:141-259) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvniysvtrkryahlsarpadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdg rlvarpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkatkvgkdelfaleqs
Timeline for d3p53a2:
View in 3D Domains from other chains: (mouse over for more information) d3p53b1, d3p53b2, d3p53b3, d3p53b4 |