SCOPe 2.07: Domain d3mdqa2: 3mdq A:128-314

Lineage for d3mdqa2 (3mdq A:128-314)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Cytophaga hutchinsonii [TaxId:269798] [267857] (1 PDB entry)

8. Domain d3mdqa2: 3mdq A:128-314 [265069]
   automated match to d1t6da2
   complexed with cl, gol, so4

Details for d3mdqa2

PDB Entry: 3mdq, 1.5 Å

PDB Description: crystal structure of an exopolyphosphatase (chu_0316) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution

PDB Compounds: (A:) exopolyphosphatase

SCOPe Domain Sequences for d3mdqa2:

Sequence; same for both SEQRES and ATOM records:

>d3mdqa2 c.55.1.0 (A:128-314) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
edhislamdigggsvefiignkneilwkqsfeiggqrlidrfhvhdpmreddrvmmhnyf
devlvplekaintwrptqligcsgtfdtlaemniqhhrekialekqtsyllslpdfnrlr
kqlvastrrerlaiagmielradmvvvaicliehvlklvstnaitvstyslkegvlytml
dgvkvgs

Timeline for d3mdqa2:

• d3mdqa2 first appeared in SCOPe 2.05
  
• d3mdqa2 appears in SCOPe 2.06
  
• d3mdqa2 appears in the current release, SCOPe 2.08