Lineage for d2todd1 (2tod D:37-43,D:284-410)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377221Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 377302Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 377322Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 377332Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)
  7. 377338Species Trypanosoma brucei [TaxId:5691] [50628] (4 PDB entries)
  8. 377342Domain d2todd1: 2tod D:37-43,D:284-410 [26492]
    Other proteins in same PDB: d2toda2, d2todb2, d2todc2, d2todd2

Details for d2todd1

PDB Entry: 2tod (more details), 2 Å

PDB Description: ornithine decarboxylase from trypanosoma brucei k69a mutant in complex with alpha-difluoromethylornithine

SCOP Domain Sequences for d2todd1:

Sequence, based on SEQRES records: (download)

>d2todd1 b.49.2.3 (D:37-43,D:284-410) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei}
gdpffvaXftlavnviakkvtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyvvs

Sequence, based on observed residues (ATOM records): (download)

>d2todd1 b.49.2.3 (D:37-43,D:284-410) Eukaryotic ornithine decarboxylase (ODC) {Trypanosoma brucei}
gdpffvaXftlavnviakkvtpaqsfmyyvndgvygsfncilydhavvrplpqrepipne
klypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyv
vs

SCOP Domain Coordinates for d2todd1:

Click to download the PDB-style file with coordinates for d2todd1.
(The format of our PDB-style files is described here.)

Timeline for d2todd1: