![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) |
![]() | Superfamily b.49.2: Alanine racemase-like, C-terminal domain [50621] (1 family) ![]() |
![]() | Family b.49.2.1: Alanine racemase-like, C-terminal domain [50622] (2 proteins) |
![]() | Protein Alanine racemase [50623] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [50624] (5 PDB entries) |
![]() | Domain d1sftb1: 1sft B:2-11,B:245-381 [26483] Other proteins in same PDB: d1sfta2, d1sftb2 |
PDB Entry: 1sft (more details), 1.9 Å
SCOP Domain Sequences for d1sftb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sftb1 b.49.2.1 (B:2-11,B:245-381) Alanine racemase {Bacillus stearothermophilus} ndfhrdtwaeXfslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlq hfhvlvdgqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletin yevpctisyrvpriffrhkrimevrnai
Timeline for d1sftb1: