Lineage for d3gcxe1 (3gcx E:293-332)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2636580Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2636581Protein automated matches [226968] (4 species)
    not a true protein
  7. 2636582Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)
  8. 2636607Domain d3gcxe1: 3gcx E:293-332 [264808]
    Other proteins in same PDB: d3gcxe2
    automated match to d2w2me_
    complexed with ca

Details for d3gcxe1

PDB Entry: 3gcx (more details), 2.7 Å

PDB Description: pcsk9:egfa (ph 7.4)
PDB Compounds: (E:) low-density lipoprotein receptor

SCOPe Domain Sequences for d3gcxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gcxe1 g.3.11.0 (E:293-332) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrce

SCOPe Domain Coordinates for d3gcxe1:

Click to download the PDB-style file with coordinates for d3gcxe1.
(The format of our PDB-style files is described here.)

Timeline for d3gcxe1: