Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.1: Diaminopimelate epimerase [54507] (1 protein) automatically mapped to Pfam PF01678 |
Protein Diaminopimelate epimerase [54508] (3 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267831] (2 PDB entries) |
Domain d3ekmc1: 3ekm C:25-158 [264761] automated match to d4ijza1 complexed with zdr |
PDB Entry: 3ekm (more details), 2.3 Å
SCOPe Domain Sequences for d3ekmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ekmc1 d.21.1.1 (C:25-158) Diaminopimelate epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gvlhfvkyhglgndfilvdnrdssepkitqeqaaklcdrnfgvgadgvifampgvngtdy amrifnsdgsepemcgngvrcfarfiaelenlqgkhsftihtgaglivpeiqddgqvkvd mgtpilkaqdvptk
Timeline for d3ekmc1: