Lineage for d3cerc1 (3cer C:11-142)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2492697Species Bifidobacterium longum [TaxId:206672] [267825] (1 PDB entry)
  8. 2492700Domain d3cerc1: 3cer C:11-142 [264716]
    automated match to d1t6da1
    complexed with so4

Details for d3cerc1

PDB Entry: 3cer (more details), 2.4 Å

PDB Description: crystal structure of the exopolyphosphatase-like protein q8g5j2. northeast structural genomics consortium target blr13
PDB Compounds: (C:) Possible exopolyphosphatase-like protein

SCOPe Domain Sequences for d3cerc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cerc1 c.55.1.0 (C:11-142) automated matches {Bifidobacterium longum [TaxId: 206672]}
mskesvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkthrfadealer
ayvaarefagviaehpidglrfvatsatrdaenreefedeierilgvrpevipgteeadl
sflgatsvvnrd

SCOPe Domain Coordinates for d3cerc1:

Click to download the PDB-style file with coordinates for d3cerc1.
(The format of our PDB-style files is described here.)

Timeline for d3cerc1: