Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Bifidobacterium longum [TaxId:206672] [267825] (1 PDB entry) |
Domain d3cerc1: 3cer C:11-142 [264716] automated match to d1t6da1 complexed with so4 |
PDB Entry: 3cer (more details), 2.4 Å
SCOPe Domain Sequences for d3cerc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cerc1 c.55.1.0 (C:11-142) automated matches {Bifidobacterium longum [TaxId: 206672]} mskesvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkthrfadealer ayvaarefagviaehpidglrfvatsatrdaenreefedeierilgvrpevipgteeadl sflgatsvvnrd
Timeline for d3cerc1:
View in 3D Domains from other chains: (mouse over for more information) d3cera1, d3cerb1, d3cerd1, d3cere1 |