Lineage for d3ak3a2 (3ak3 A:93-210)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2553188Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2553189Protein automated matches [226860] (37 species)
    not a true protein
  7. 2553205Species Aeropyrum pernix [TaxId:272557] [267822] (3 PDB entries)
  8. 2553210Domain d3ak3a2: 3ak3 A:93-210 [264692]
    Other proteins in same PDB: d3ak3a1, d3ak3b1, d3ak3c1, d3ak3d1
    automated match to d1p7ga2
    complexed with edo, fe

Details for d3ak3a2

PDB Entry: 3ak3 (more details), 1.48 Å

PDB Description: Superoxide dismutase from Aeropyrum pernix K1, Fe-bound form
PDB Compounds: (A:) Superoxide dismutase [Mn/Fe]

SCOPe Domain Sequences for d3ak3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ak3a2 d.44.1.0 (A:93-210) automated matches {Aeropyrum pernix [TaxId: 272557]}
ggtpggrvadliekqfggfekfkalfsaaaktvegvgwgvlafdplteelrilqvekhnv
lmtaglvpilvidvwehayylqykndrgsyvenwwnvvnwddvekrleqalnnakply

SCOPe Domain Coordinates for d3ak3a2:

Click to download the PDB-style file with coordinates for d3ak3a2.
(The format of our PDB-style files is described here.)

Timeline for d3ak3a2: