Class b: All beta proteins [48724] (141 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88678] (10 PDB entries) |
Domain d1efrf2: 1efr F:9-81 [26469] Other proteins in same PDB: d1efra1, d1efra2, d1efra3, d1efrb1, d1efrb2, d1efrb3, d1efrc1, d1efrc2, d1efrc3, d1efrd1, d1efrd3, d1efre1, d1efre3, d1efrf1, d1efrf3, d1efrg_ complexed with adp, anp, app, bal, cpi, mg, tlx |
PDB Entry: 1efr (more details), 3.1 Å
SCOP Domain Sequences for d1efrf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efrf2 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)} ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg lvrgqkvldsgap
Timeline for d1efrf2: