SCOPe 2.07: Domain d2qjna1: 2qjn A:1-111

Lineage for d2qjna1 (2qjn A:1-111)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:48935] [267801] (3 PDB entries)

8. Domain d2qjna1: 2qjn A:1-111 [264476]
   Other proteins in same PDB: d2qjna2, d2qjnb2, d2qjnc2, d2qjnd2
   automated match to d4il2a1
   complexed with kdg, mg

Details for d2qjna1

PDB Entry: 2qjn, 2 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Novosphingobium aromaticivorans complexed with Mg and 2-keto-3-deoxy-D-gluconate

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2qjna1:

Sequence; same for both SEQRES and ATOM records:

>d2qjna1 d.54.1.0 (A:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg

Timeline for d2qjna1:

• d2qjna1 first appeared in SCOPe 2.05
  
• d2qjna1 appears in SCOPe 2.06
  
• d2qjna1 appears in the current release, SCOPe 2.08