Lineage for d1e79d2 (1e79 D:9-81)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955060Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 955061Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 955062Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 955115Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 955118Species Cow (Bos taurus) [TaxId:9913] [88678] (12 PDB entries)
    Uniprot P00829
  8. 955122Domain d1e79d2: 1e79 D:9-81 [26437]
    Other proteins in same PDB: d1e79a1, d1e79a2, d1e79a3, d1e79b1, d1e79b2, d1e79b3, d1e79c1, d1e79c2, d1e79c3, d1e79d1, d1e79d3, d1e79e1, d1e79e3, d1e79f1, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_
    complexed with adp, atp, dcw, gol, mg, so4

Details for d1e79d2

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)
PDB Compounds: (D:) ATP synthase beta chain

SCOPe Domain Sequences for d1e79d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e79d2 b.49.1.1 (D:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d1e79d2:

Click to download the PDB-style file with coordinates for d1e79d2.
(The format of our PDB-style files is described here.)

Timeline for d1e79d2: