Lineage for d1e79c2 (1e79 C:19-94)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408139Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2408140Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)
  7. 2408159Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
    Uniprot P19483
  8. 2408174Domain d1e79c2: 1e79 C:19-94 [26436]
    Other proteins in same PDB: d1e79a1, d1e79a3, d1e79b1, d1e79b3, d1e79c1, d1e79c3, d1e79d1, d1e79d2, d1e79d3, d1e79e1, d1e79e2, d1e79e3, d1e79f1, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_
    complexed with adp, atp, dcw, gol, mg, so4

Details for d1e79c2

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)
PDB Compounds: (C:) ATP synthase alpha chain heart isoform

SCOPe Domain Sequences for d1e79c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e79c2 b.49.1.1 (C:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

SCOPe Domain Coordinates for d1e79c2:

Click to download the PDB-style file with coordinates for d1e79c2.
(The format of our PDB-style files is described here.)

Timeline for d1e79c2: