Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (2 families) |
Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) |
Protein GCN4 [57961] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (65 PDB entries) Uniprot P03069 249-279 ! Uniprot P03069 249-281 |
Domain d2ipzc_: 2ipz C: [264318] automated match to d2nrnd_ complexed with gol, ipa |
PDB Entry: 2ipz (more details), 1.35 Å
SCOPe Domain Sequences for d2ipzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ipzc_ h.1.3.1 (C:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mkvkqlvdkveellsknyhlvnevarlvklvger
Timeline for d2ipzc_: