SCOPe 2.07: Domain d1x6ga1: 1x6g A:8-75

Lineage for d1x6ga1 (1x6g A:8-75)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)

8. Domain d1x6ga1: 1x6g A:8-75 [264212]
   Other proteins in same PDB: d1x6ga2, d1x6ga3
   automated match to d2gqia_

Details for d1x6ga1

PDB Entry: 1x6g

PDB Description: solution structures of the sh3 domain of human megakaryocyte- associated tyrosine-protein kinase.

PDB Compounds: (A:) Megakaryocyte-associated tyrosine-protein kinase

SCOPe Domain Sequences for d1x6ga1:

Sequence; same for both SEQRES and ATOM records:

>d1x6ga1 b.34.2.0 (A:8-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rmptrrwapgtqcitkcehtrpkpgelafrkgdvvtileacenkswyrvkhhtsgqegll
aagalrer

Timeline for d1x6ga1:

• d1x6ga1 first appeared in SCOPe 2.05, called d1x6ga_
  
• d1x6ga1 appears in SCOPe 2.06
  
• d1x6ga1 appears in the current release, SCOPe 2.08