SCOPe 2.06: Domain d1x66a1: 1x66 A:8-92

Lineage for d1x66a1 (1x66 A:8-92)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (22 PDB entries)

8. Domain d1x66a1: 1x66 A:8-92 [264211]
   Other proteins in same PDB: d1x66a2, d1x66a3
   automated match to d2dkxa_

Details for d1x66a1

PDB Entry: 1x66

PDB Description: solution structure of the sam_pnt-domain of the human friend leukemiaintegration 1 transcription factor

PDB Compounds: (A:) Friend leukemia integration 1 transcription factor

SCOPe Domain Sequences for d1x66a1:

Sequence; same for both SEQRES and ATOM records:

>d1x66a1 a.60.1.0 (A:8-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppnmttnerrvivpadptlwtqehvrqwlewaikeyslmeidtsffqnmdgkelckmnke
dflrattlyntevllshlsylress

Timeline for d1x66a1:

• d1x66a1 first appeared in SCOPe 2.05, called d1x66a_
  
• d1x66a1 appears in SCOPe 2.07
  
• d1x66a1 appears in the current release, SCOPe 2.08