Lineage for d1vw4h_ (1vw4 H:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648196Protein Eukaryotic, mitochondrial (54S or 39S subunit) [267635] (2 species)
  7. 2648197Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [268005] (1 PDB entry)
  8. 2648215Domain d1vw4h_: 1vw4 H: [264170]
    protein/RNA complex; complexed with mg, zn

Details for d1vw4h_

PDB Entry: 1vw4 (more details), 3.2 Å

PDB Description: Structure of the yeast mitochondrial large ribosomal subunit
PDB Compounds: (H:) 54S ribosomal protein L23, mitochondrial

SCOPe Domain Sequences for d1vw4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vw4h_ i.1.1.2 (H:) Eukaryotic, mitochondrial (54S or 39S subunit) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqkighsglafarlwhhvdvardkrtlgrlasaiaitligrhkpvyhpsqdcgdyvvvtn
cqkirvtgkkfeqktywshsgrpgqlklqtmnkvvadkgfgeilkkavsgmlpknklrkq
rldrlkvfdgsenpykqnitafaheqss

SCOPe Domain Coordinates for d1vw4h_:

Click to download the PDB-style file with coordinates for d1vw4h_.
(The format of our PDB-style files is described here.)

Timeline for d1vw4h_: