Lineage for d1vw4d_ (1vw4 d:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043618Protein Eukaryotic, mitochondrial (54S or 39S subunit) [267635] (2 species)
  7. 3043619Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [268005] (1 PDB entry)
  8. 3043633Domain d1vw4d_: 1vw4 d: [264166]
    Mitochondrial homologous recombination protein 1, MHR1
    protein/RNA complex; complexed with mg, zn

Details for d1vw4d_

PDB Entry: 1vw4 (more details), 3.2 Å

PDB Description: Structure of the yeast mitochondrial large ribosomal subunit
PDB Compounds: (d:) Mitochondrial homologous recombination protein 1

SCOPe Domain Sequences for d1vw4d_:

Sequence, based on SEQRES records: (download)

>d1vw4d_ i.1.1.2 (d:) Eukaryotic, mitochondrial (54S or 39S subunit) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvnhsisrfrpaswfektkiippqvyifrnleygqvlysqfpnfsqtqvdklfvrpnwsn
rkpslrrdiwkcmcvvnlqnykqsvhlyqnlcrlrylrdvaqrkesdklrkkdsnghvwy
sgqyrptycqeavadlresllkvfenatpaekqtvpakkpsiywedpwrmgdkdkhwnyd
vfnalglehkliqrvgniareesvilkelakle

Sequence, based on observed residues (ATOM records): (download)

>d1vw4d_ i.1.1.2 (d:) Eukaryotic, mitochondrial (54S or 39S subunit) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvnhsisrfrpaswfektkiippqvyifrnleygqvlysqfpnfsqtqvdklfvrpnwsn
rkpslrrdiwkcmcvvnlqnykqsvhlyqnlcrlrylrdvaqrkesdklrkkdsnghvwy
sgqyrptycqeavadlresllkvfenaakkpsiywedpwrmgdkdkhwnydvfnalgleh
kliqrvgniareesvilkelakle

SCOPe Domain Coordinates for d1vw4d_:

Click to download the PDB-style file with coordinates for d1vw4d_.
(The format of our PDB-style files is described here.)

Timeline for d1vw4d_: