| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (3 proteins) |
| Protein Eukaryotic, mitochondrial (54S or 39S subunit) [267635] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [268005] (1 PDB entry) |
| Domain d1vw4y_: 1vw4 Y: [264187] protein/RNA complex; complexed with mg, zn |
PDB Entry: 1vw4 (more details), 3.2 Å
SCOPe Domain Sequences for d1vw4y_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vw4y_ i.1.1.2 (Y:) Eukaryotic, mitochondrial (54S or 39S subunit) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
srgntyqpstlkrkrtfgflarakskqgskilkrrklkgrwflsh
Timeline for d1vw4y_:
View in 3DDomains from other chains: (mouse over for more information) d1vw40_, d1vw41_, d1vw42_, d1vw43_, d1vw44_, d1vw45_, d1vw46_, d1vw47_, d1vw48_, d1vw49_, d1vw4a_, d1vw4b_, d1vw4c_, d1vw4d_, d1vw4e_, d1vw4f_, d1vw4g_, d1vw4h_, d1vw4i_, d1vw4j_, d1vw4k_, d1vw4l_, d1vw4m_, d1vw4n_, d1vw4o_, d1vw4p_, d1vw4q_, d1vw4r_, d1vw4s_, d1vw4t_, d1vw4u_, d1vw4v_, d1vw4w_, d1vw4x_, d1vw4z_ |