Lineage for d4whty1 (4wht Y:1-111)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2371423Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (18 PDB entries)
  8. 2371446Domain d4whty1: 4wht Y:1-111 [264109]
    Other proteins in same PDB: d4whtb2, d4whtd2, d4whtl2, d4whtn2, d4whtp2, d4whtr2, d4whtt2, d4whtv2, d4whty2
    automated match to d1c5da1

Details for d4whty1

PDB Entry: 4wht (more details), 2.22 Å

PDB Description: Structure of the Hepatitis C virus envelope glycoprotein E2 antigenic region 412-423 bound to the broadly neutralizing antibody 3/11, P1 crystal form
PDB Compounds: (Y:) Light chain of the Fab fragment derived from neutralizing antibody 3/11

SCOPe Domain Sequences for d4whty1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4whty1 b.1.1.0 (Y:1-111) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
divltqttptlsatigqsvsiscrssqsllesdgntylnwllqrpgqspqlliysvsnle
sgvpnrfsgsgsetdftlkisgveaedlgvyycmqtthaptfgagtklelk

SCOPe Domain Coordinates for d4whty1:

Click to download the PDB-style file with coordinates for d4whty1.
(The format of our PDB-style files is described here.)

Timeline for d4whty1: