SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4w9gb_ (4w9g B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2169177Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2169178Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2169179Family d.42.1.1: BTB/POZ domain [54696] (6 protein domains)
  6. 2169237Protein Elongin C [54699] (3 species)
  7. 2169240Species Human (Homo sapiens) [TaxId:9606] [54700] (32 PDB entries)
  8. 2169323Domain d4w9gb_: 4w9g B: [264053]
    Other proteins in same PDB: d4w9ga_, d4w9gc_, d4w9gd_, d4w9gf_, d4w9gg_, d4w9gi_, d4w9gj_, d4w9gk2, d4w9gl_
    automated match to d4b9kb_
    complexed with 3jv

Details for d4w9gb_

PDB Entry: 4w9g (more details), 2.7 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-(3,3-dimethylbutanoyl)-4-hydroxy-N-(3-methyl-4-(thiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 6)
PDB Compounds: (B:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4w9gb_:

Sequence, based on SEQRES records: (download)

>d4w9gb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4w9gb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4w9gb_:

Click to download the PDB-style file with coordinates for d4w9gb_.
(The format of our PDB-style files is described here.)

Timeline for d4w9gb_: