| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
| Family b.3.3.1: VHL [49469] (2 proteins) |
| Protein VHL [49470] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
| Domain d4w9gi_: 4w9g I: [259580] Other proteins in same PDB: d4w9ga_, d4w9gb_, d4w9gd_, d4w9ge_, d4w9gg_, d4w9gh_, d4w9gj_, d4w9gk1, d4w9gk2 automated match to d1lqbc_ complexed with 3jv |
PDB Entry: 4w9g (more details), 2.7 Å
SCOPe Domain Sequences for d4w9gi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9gi_ b.3.3.1 (I:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe
Timeline for d4w9gi_: