Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries) |
Domain d4w9dj_: 4w9d J: [264034] Other proteins in same PDB: d4w9db_, d4w9dc_, d4w9de_, d4w9df_, d4w9dh_, d4w9di_, d4w9dk1, d4w9dk2, d4w9dl_ automated match to d1lqba_ complexed with 3jk |
PDB Entry: 4w9d (more details), 2.2 Å
SCOPe Domain Sequences for d4w9dj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9dj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d4w9dj_: