SCOPe 2.06: Domain d4tkze_: 4tkz E:

Lineage for d4tkze_ (4tkz E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.0: automated matches [191356] (1 protein)
   not a true family

6. Protein automated matches [190395] (7 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:211110] [259107] (1 PDB entry)

8. Domain d4tkze_: 4tkz E: [263903]
   automated match to d3iprc_
   complexed with gol

Details for d4tkze_

PDB Entry: 4tkz, 1.8 Å

PDB Description: crystal structure of phosphotransferase system component eiia from streptococcus agalactiae

PDB Compounds: (E:) Putative uncharacterized protein gbs1890

SCOPe Domain Sequences for d4tkze_:

Sequence; same for both SEQRES and ATOM records:

>d4tkze_ c.54.1.0 (E:) automated matches {Streptococcus agalactiae [TaxId: 211110]}
mikiiivahgnfpdgilssleliaghqeyvvginfiagmssndvrvalqrevidfkeilv
ltdllggtpfnvssalsveytdkkikvlsglnlsmlmeavlsrtmfehvddlvdkvitss
hegivdfstc

Timeline for d4tkze_:

• d4tkze_ first appeared in SCOPe 2.05
  
• d4tkze_ appears in SCOPe 2.07
  
• d4tkze_ appears in the current release, SCOPe 2.08