SCOPe 2.07: Domain d4qg7a_: 4qg7 A:

Lineage for d4qg7a_ (4qg7 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [193407] (9 PDB entries)

8. Domain d4qg7a_: 4qg7 A: [263699]
   automated match to d2ccgb_
   complexed with 32k

Details for d4qg7a_

PDB Entry: 4qg7, 1.67 Å

PDB Description: s.aureus tmk in complex with a potent inhibitor compound 18, 2-(3-chlorophenoxy)-3-methoxy-4-{[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]methyl}benzoic acid

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4qg7a_:

Sequence, based on SEQRES records:

>d4qg7a_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyleki

Sequence, based on observed residues (ATOM records):

>d4qg7a_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriikndqedlkfhekviegyqeiihnesqrfksvnadqple
nvvedtyqtiikyleki

Timeline for d4qg7a_:

• d4qg7a_ first appeared in SCOPe 2.05
  
• d4qg7a_ appears in SCOPe 2.06
  
• d4qg7a_ appears in the current release, SCOPe 2.08