Lineage for d4qfwd1 (4qfw D:116-285)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188470Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2188471Protein automated matches [190143] (36 species)
    not a true protein
  7. 2188759Species Yersinia pestis [TaxId:187410] [226504] (3 PDB entries)
  8. 2188778Domain d4qfwd1: 4qfw D:116-285 [263697]

Details for d4qfwd1

PDB Entry: 4qfw (more details), 2 Å

PDB Description: crystal structure of acyl-coa thioesterase tesb from yersinia pestis
PDB Compounds: (D:) acyl-coa thioesterase II

SCOPe Domain Sequences for d4qfwd1:

Sequence, based on SEQRES records: (download)

>d4qfwd1 d.38.1.0 (D:116-285) automated matches {Yersinia pestis [TaxId: 187410]}
ehqntmpdvpppeglmsetdiarqfshlipekvrekfigpqpiemrpvkfhnplqgsvee
pnryvwfrangkmpddlrvhqyllgyasdfnflptalqphgigflepgmqiatidhsmwf
hrpfrlddwllyavestsasgargfvrgqiynregvlvastvqegvirlh

Sequence, based on observed residues (ATOM records): (download)

>d4qfwd1 d.38.1.0 (D:116-285) automated matches {Yersinia pestis [TaxId: 187410]}
ehqntmpdvpppeglmsetdiarqgpqpiemrpvkfhnplqgsveepnryvwfrangkmp
ddlrvhqyllgyasdfnflptalqphgigflepgmqiatidhsmwfhrpfrlddwllyav
estsasgargfvrgqiynregvlvastvqegvirlh

SCOPe Domain Coordinates for d4qfwd1:

Click to download the PDB-style file with coordinates for d4qfwd1.
(The format of our PDB-style files is described here.)

Timeline for d4qfwd1: