Lineage for d1qrzc_ (1qrz C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298675Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 298676Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 298774Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins)
  6. 299098Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 299099Species Human (Homo sapiens) [TaxId:9606] [50589] (6 PDB entries)
  8. 299106Domain d1qrzc_: 1qrz C: [26368]

Details for d1qrzc_

PDB Entry: 1qrz (more details), 2 Å

PDB Description: catalytic domain of plasminogen

SCOP Domain Sequences for d1qrzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrzc_ b.47.1.2 (C:) Plasmin(ogen), catalytic domain {Human (Homo sapiens)}
fdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgqhfcggtlispewvltaahcl
eksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipa
clpspnymvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqstel
caghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwie
gvlrnn

SCOP Domain Coordinates for d1qrzc_:

Click to download the PDB-style file with coordinates for d1qrzc_.
(The format of our PDB-style files is described here.)

Timeline for d1qrzc_: