Class b: All beta proteins [48724] (126 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins) |
Protein Plasmin(ogen), catalytic domain [50588] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50589] (6 PDB entries) |
Domain d1qrzc_: 1qrz C: [26368] |
PDB Entry: 1qrz (more details), 2 Å
SCOP Domain Sequences for d1qrzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qrzc_ b.47.1.2 (C:) Plasmin(ogen), catalytic domain {Human (Homo sapiens)} fdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgqhfcggtlispewvltaahcl eksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipa clpspnymvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqstel caghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwie gvlrnn
Timeline for d1qrzc_: